Anti-KIT Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	NP_000213
Gene Id	3815
Gene Symbols	KIT
Protein Name / Synonyms	C-Kit, CD117, PBT, SCFR
Clonality	Monoclonal
Immunogen Sequence	PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQN EWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTD
Isotype	Kappa, IgG2b
Recommended Applications	ELISA, IHC, Proximity Ligation Analysis, Western Blotting
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

C-Kit, CD117, PBT, SCFR

Mouse monoclonal antibody raised against a partial recombinant KIT.

Specificity

Human

Gene Accession #

NM_000222

Storage Buffer

1x PBS, pH 7.2

	Western Blot detection against Immunogen (36.63 KDa).
	Proximity Ligation Analysis of protein-protein interactions between STAT1 and KIT HeLa cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-KIT mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
	Immunoperoxidase of monoclonal antibody to KIT on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 3 ug/ml]
	Detection limit for recombinant GST tagged KIT is 0.03 ng/ml as a capture antibody.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description