3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-LEAP-2 Antibody
Catalog #: 131-0130
Product Description
Specifications
| Size | 20 µg, 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | Q969E1 |
| Gene Id | 116842 |
| Gene Symbols | LEAP2 |
| Protein Name / Synonyms | LEAP-2 (38-77) |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen LEAP-2 (38-77):MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE. This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
| Recommended Applications | ELISA (recommended work dilution = 1:10, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1 x PBS. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Liver-expressed antimicrobial peptide is generally referred to peptides which exhibit antimicrobial activity expressed in many species. Liver-expressed antimicrobial peptide 2 (LEAP-2) is involved into blood circulation after secreted from the liver, and exhibits antimicrobial activity and others effects as well.
Storage
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Expiration:
12 months from the date of shipment when stored properly.