3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 131-0130
| Size | 20 µg, 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | Q969E1 |
| Gene Id | 116842 |
| Gene Symbols | LEAP2 |
| Protein Name / Synonyms | LEAP-2 (38-77) |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen LEAP-2 (38-77):MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE. This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
| Recommended Applications | ELISA (recommended work dilution = 1:10, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1 x PBS. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.