3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10927
Human LOC493829 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_001008275.1 |
| Gene Id | 493829 |
| Gene Symbols | LOC493829,TRIM72 |
| Protein Name / Synonyms | None |
| Clonality | Monoclonal |
| Immunogen Sequence | QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYL SFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCW HDKGKNAQPLLLVGPEGAEA |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Immunoprecipitation of TRIM72 transfected lysate using anti-TRIM72 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM72 MaxPab rabbit polyclonal antibody. |
![]() | Detection limit for recombinant GST tagged TRIM72 is 0.3 ng/ml as a capture antibody. |
Your cart is empty.