3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10929
Human LRIT3 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_940908 |
| Gene Id | 345193 |
| Gene Symbols | LRIT3 |
| Protein Name / Synonyms | FIGLER4, FLJ44691, MGC120618 |
| Clonality | Monoclonal |
| Immunogen Sequence | KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWT RSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (33.99 KDa). |
![]() | Western Blot analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody. Lane 1: LRIT3 transfected lysate(60.521 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to LRIT3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.2 ug/ml] |
![]() | Detection limit for recombinant GST tagged LRIT3 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.