3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10944
Human MAP2K5 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH08838 |
| Gene Id | 5607 |
| Gene Symbols | MAP2K5 |
| Protein Name / Synonyms | HsT17454, MAPKK5, MEK5, PRKMK5 |
| Clonality | Monoclonal |
| Immunogen Sequence | MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLL FRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKA MLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunofluorescence, Proximity Ligation Analysis, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (38.83 KDa). |
![]() | Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and MAP2K5 HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-MAP2K5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.