3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10946
Human MAP3K4 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse |
| Host Species | Mouse |
| Accession Number | NP_005913 |
| Gene Id | 4216 |
| Gene Symbols | MAP3K4 |
| Protein Name / Synonyms | FLJ42439, KIAA0213, MAPKKK4, MEKK4, MTK1, PRO0412 |
| Clonality | Monoclonal |
| Immunogen Sequence | AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAA ELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTL ISQSKDTASKLGPIEAIQKS |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | MAP3K4 monoclonal antibody Western Blot analysis of MAP3K4 expression in NIH/3T3 . |
Sign up to get promotions on your favorite research tools and research updates.
Your cart is empty.