3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10996
Human MGC10540 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH06282 |
| Gene Id | 84313 |
| Gene Symbols | MGC10540,VPS25 |
| Protein Name / Synonyms | DERP9, EAP20, FAP20, MGC10540 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSF CRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEE LRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQ NNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEH KAEIITVSDGRGVKFF |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (45.1 KDa). |
![]() | MGC10540 monoclonal antibody 2B9 Western Blot analysis of MGC10540 expression in Hela NE . |
![]() | Immunofluorescence of monoclonal antibody to VPS25 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged VPS25 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.