3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10997
Human MGC26963 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_689834 |
| Gene Id | 166929 |
| Gene Symbols | MGC26963,SGMS2 |
| Protein Name / Synonyms | MGC26963, SMS2 |
| Clonality | Monoclonal |
| Immunogen Sequence | DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGK PKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (34.43 KDa). |
![]() | MGC26963 monoclonal antibody. Western Blot analysis of SGMS2 expression in human stomach. |
![]() | Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MGC26963 monoclonal antibody . GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | Western Blot analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody . Lane 1: MGC26963 transfected lysate(42.3 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.