3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-Mouse BD-1 (33-66aa) Antibody
Catalog #: 130-10731
Rabbit anti-Mouse/Rat BD-1 (33-66aa) Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Mouse, Rat |
| Host Species | Rabbit |
| Accession Number | P56386 |
| Gene Id | 13214 |
| Gene Symbols | Defb1 |
| Protein Name / Synonyms | BD-1 (33-66aa) |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen Mouse/Rat BD-1 (33-66aa): DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNC. This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNC |
| Recommended Applications | ELISA (recommended work dilution = 1:320, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Research Area | Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
BD-1 has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Storage
Store at 4°C if intended for use within one month, otherwise, store at -20°C to -80°C. The lyophilized antibody is stable for at least 18 months after the date of receipt when stored at -20°C to -80°C. After reconstitution, it can also be aliquoted and stored frozen at -20°C to -80°C in a manual defrost freezer for 6 months without detectable loss of activity. Upon reconstitution, the antibody can also be stored for 30 days at 4°C. Please avoid freeze-thaw cycles, as this will lower the activity of the antibody.
Expiration:
12 months from the date of shipment when stored properly.