3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11013
Human MPG monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH14991 |
| Gene Id | 4350 |
| Gene Symbols | MPG |
| Protein Name / Synonyms | AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg |
| Clonality | Monoclonal |
| Immunogen Sequence | MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQP HSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTR LGLEFFDQPA |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.53 KDa). |
![]() | MPG monoclonal antibody Western Blot analysis of MPG expression in Hela NE . |
![]() | Immunofluorescence of monoclonal antibody to MPG on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged MPG is approximately 10ng/ml as a capture antibody. |
Your cart is empty.