3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11086
Human NEK2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | AAH43502 |
| Gene Id | 4751 |
| Gene Symbols | NEK2 |
| Protein Name / Synonyms | HsPK21, NEK2A, NLK1 |
| Clonality | Monoclonal |
| Immunogen Sequence | EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNP ELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKC KDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (38.28 KDa). |
![]() | NEK2 monoclonal antibody Western Blot analysis of NEK2 expression in Raw 264.7 . |
![]() | NEK2 monoclonal antibody Western Blot analysis of NEK2 expression in PC-12 . |
![]() | NEK2 monoclonal antibody Western Blot analysis of NEK2 expression in NIH/3T3 . |
![]() | NEK2 monoclonal antibody Western Blot analysis of NEK2 expression in MCF-7 . |
![]() | Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 25 ug/ml] |
![]() | Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody. |
Your cart is empty.