3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11093
Human NEUROG3 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_066279 |
| Gene Id | 50674 |
| Gene Symbols | NEUROG3 |
| Protein Name / Synonyms | Atoh5, Math4B, bHLHa7, ngn3 |
| Clonality | Monoclonal |
| Immunogen Sequence | MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPT RTRGNCAEAEEGGCRGAPRKLRARRGGRSRPKSELALSKQ RRSRRKKANDRERNRMHNLN* |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Immunoprecipitation, Immunofluorescence, ELISA, Western Blotting |
| Research Area | Neuroscience |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.11 KDa). |
![]() | Immunoprecipitation of NEUROG3 transfected lysate using anti-NEUROG3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEUROG3 MaxPab rabbit polyclonal antibody. |
![]() | Immunofluorescence of monoclonal antibody to NEUROG3 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.