3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11118
Human NLK monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | AAH64663 |
| Gene Id | 51701 |
| Gene Symbols | NLK |
| Protein Name / Synonyms | DKFZp761G1211, FLJ21033 |
| Clonality | Monoclonal |
| Immunogen Sequence | DEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTF EKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKS FISSTVAQPSEMPPSPLVWE |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, Proximity Ligation Analysis, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | NLK monoclonal antibody. Western Blot analysis of NLK expression in human liver. |
![]() | NLK monoclonal antibody. Western Blot analysis of NLK expression in PC-12. |
![]() | NLK monoclonal antibody. Western Blot analysis of NLK expression in NIH/3T3. |
![]() | NLK monoclonal antibody Western Blot analysis of NLK expression in HepG2 . |
![]() | Western Blot analysis of NLK expression in transfected 293T cell line by NLK monoclonal antibody . Lane 1: NLK transfected lysate (Predicted MW: 57.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and NLK HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-NLK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Your cart is empty.