3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-NMB (25-55aa) Antibody
Catalog #: 130-10521
Rabbit Anti-Human NMB (25-55aa) Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | P08949 |
| Gene Id | 4828 |
| Gene Symbols | NMB |
| Protein Name / Synonyms | Neuromedin-B [Cleaved into: Neuromedin-B-32, Neuromedin-B] |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen (NMB:25-55aa):APLSWDLPEPRSRASKIRVHSRGNLWATGHFC ).This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | APLSWDLPEPRSRASKIRVHSRGNLWATGHFC |
| Recommended Applications | ELISA (recommended work dilution= 1:64, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Neuromedin B (NMB) is a bombesin-related peptide in mammals. It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.
Storage
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Expiration:
12 months from the date of shipment when stored properly.