3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11122
Human NOLC1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_004732 |
| Gene Id | 9221 |
| Gene Symbols | NOLC1 |
| Protein Name / Synonyms | KIAA0035, NOPP130, NOPP140, NS5ATP13, P130 |
| Clonality | Monoclonal |
| Immunogen Sequence | EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVR EEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKS FRHEKTKKKRGSYRGGSISVQVNSIKFDSE |
| Isotype | Kappa, IgG3 |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | NOLC1 monoclonal antibody Western Blot analysis of NOLC1 expression in HepG2 . |
![]() | Immunoperoxidase of monoclonal antibody to NOLC1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml] |
![]() | Detection limit for recombinant GST tagged NOLC1 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.