3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: RB-19-0001B-50
Rabbit anti-NPF Biotinylated Antibody, 50 ug
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | NP_536741 |
| Clonality | Polyclonal |
| Immunogen | Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1: 1, 000-5, 000) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.