3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: RB-19-0001
Rabbit Anti-NPF Antibody
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | NP_536741 |
| Clonality | Polyclonal |
| Immunogen | Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF |
| Recommended Applications | ELISA (recommended work dilution= 1: 1, 000-5, 000) |
| Reconstitution | Antibody is supplied lyophilized originally containing PBS without preservative stabilizers. The antibody is stable for at least a year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody (recommended with H20 1 mg/ml) can also be aliquoted and stored frozen at -20°C to -70°C in a manual defrost freezer for months without detectable loss activity. Upon reconstitution, the antibody may also be stored for months at 4°C. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.