3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-NPF Receptor (N-term) Antibody
Catalog #: RB-19-0003
Rabbit Anti-NPF Receptor (N-terminus) Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Accession Number | NP_524245 |
| Clonality | Polyclonal |
| Immunogen | Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | YNKLKSRITVVAVQASSAQRKVERGRRMKRTNC |
| Recommended Applications | ELISA (recommended work dilution= 1: 1, 000-5, 000) |
| Reconstitution | Antibody is supplied lyophilized originally containing PBS without preservative stabilizers. Final concentration is indicated on shipping vial. The antibody is stable for at least a year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody (recommended with H20 1 mg/ml) can also be aliquoted and stored frozen at -20°C to -70°C in a manual defrost freezer for months without detectable loss activity. Upon reconstitution, the antibody may also be stored for months at 4°C. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Drosophila has a similar signaling system as other species do. The system consists of neurons expressing neuropeptide F (NPF) and its receptor, NPFR. NPF has high homology with mammalian neuropeptide Y. The NPF neural system is comprised of four to six NPF neurons located in the brain and subesophageal ganglia. In response to chemosensory stimulation by sugar, the NPF neuronal circuit undergoes long-term, dose-dependent modifications through NPF activation and an increase in the number of NPF -positive varicosities. These properties of the NPF neurons support its potential role in the regulation of food-related behaviors.
The receptor belongs to the G protein-coupled receptor (GPCR) superfamily. To date, some forty GPCRs are categorized as neuropeptide GPCRs in Drosophila, and about two-thirds of these receptors have been deorphanized.
The receptor belongs to the G protein-coupled receptor (GPCR) superfamily. To date, some forty GPCRs are categorized as neuropeptide GPCRs in Drosophila, and about two-thirds of these receptors have been deorphanized.
Specificity
The rabbit anti-Drosophila Neuropeptide F antibody shows strong binding to the synthetic immunogen. Its binding activity to native protein or cross reactivity with the protein derived from other species was not tested.
Storage
Store at 4°C if intended for use within a month, otherwise store at -20°C. Minimize freeze-thaw cycles.
Related Products
Rabbit Anti-Neuropeptide F receptor(C-terminus) Cat#RB-19-0002; Rabbit Anti-Neuropeptide F receptor(N-terminus) Cat#RB-19-0003
References
- Lee, K. S., You, K. H., Choo, J. K., Han, Y. M. and Yu, K. (2004). Drosophila short neuropeptide F regulates food intake and body size. J. Biol. Chem. 279(49): 50781-9.
- Mertens I, et.al., Characterization of the short neuropeptide F receptor from Drosophila melanogaster. Biochem Biophys Res Commun. 2002 Oct 11;297(5):1140-8.
Expiration:
12 months from the date of shipment when stored properly.