3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11137
Human NR4A2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH66890 |
| Gene Id | 4929 |
| Gene Symbols | NR4A2 |
| Clonality | Monoclonal |
| Immunogen Sequence | GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRL SLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVV DGQTFAVPNPIRKPASMGFP |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 0.5mg/ml |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | NR4A2 monoclonal antibody Western Blot analysis of NR4A2 expression in Hela NE . |
![]() | Western Blot analysis of NR4A2 expression in transfected 293T cell line by NR4A2 monoclonal antibody . Lane 1: NR4A2 transfected lysate(66.6 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged NR4A2 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.