3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11166
Human ORC1L monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH11539 |
| Gene Id | 4998 |
| Gene Symbols | ORC1L |
| Protein Name / Synonyms | HSORC1, ORC1, PARC1 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEG CSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPP KKRARVQWFVRFCEVPACKRHLLGRKPGAQ |
| Isotype | Kappa, IgG2b |
| Recommended Applications | ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Immunoperoxidase of monoclonal antibody to ORC1L on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged ORC1L is 0.3 ng/ml as a capture antibody. |
Your cart is empty.