3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11167
Human ORM1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH26238 |
| Gene Id | 5004 |
| Gene Symbols | ORM1 |
| Clonality | Monoclonal |
| Immunogen Sequence | AQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNK SVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYL NVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDE KNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTD WKKDKCEPLEKQHEKERKQEEGES |
| Isotype | Kappa, IgG1 |
| Concentration (lot specific) | 0.5mg/ml |
| Recommended Applications | Immunoprecipitation, Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (45.98 KDa). | ||||
![]() | Western blot analysis of ORM1 over-expressed 293 cell line, cotransfected with ORM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ORM1 monoclonal antibody 1F10. GAPDH ( 36.1 kDa ) used as specificity and loading control. | ||||
![]() | ORM1 monoclonal antibody 1F10 Western Blot analysis of ORM1 expression in MCF-7 . | ||||
![]() | Western Blot analysis of ORM1 expression in transfected 293T cell line by ORM1 monoclonal antibody 1F10. Lane 1: ORM1 transfected lysate(23.5 KDa). Lane 2: Non-transfected lysate. | ![]() | Immunoperoxidase of monoclonal antibody to ORM1 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 1 ug/ml] | ![]() | Immunoprecipitation of ORM1 transfected lysate using anti-ORM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ORM1 MaxPab rabbit polyclonal antibody. |
![]() | Detection limit for recombinant GST tagged ORM1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.