3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 130-11069
Rabbit Anti-Human P53 (2-29aa) Antibody
| Size | 20 µg, 100 µg, 200 µg, 500 µg, 1 mg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P04637 |
| Gene Id | 7157 |
| Gene Symbols | TP53, P53 |
| Protein Name / Synonyms | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) |
| Clonality | Polyclonal |
| Preparation | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen P53 (2-29aa): EEPQSDPSVEPPLSQETFSDLWKLLPENG. This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen | Synthetic immunogen P53 (2-29aa): EEPQSDPSVEPPLSQETFSDLWKLLPENG |
| Recommended Applications | ELISA (recommended work dilution= 1:5, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in glycine solution. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Research Area | Apoptosis, Cancer, p53 Signaling, Autophagy, DNA Damage |
| Shipping Type | Blue ice |
| Storage | -20°C |
Your cart is empty.