3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11179
Human PAK1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_002567 |
| Gene Id | 5058 |
| Gene Symbols | PAK1 |
| Protein Name / Synonyms | MGC130000, MGC130001, PAKalpha |
| Clonality | Monoclonal |
| Immunogen Sequence | APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTT PPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKY TRFEKIGQGA |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, Immunoprecipitation, ELISA, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.53 KDa). |
![]() | PAK1 monoclonal antibody Western Blot analysis of PAK1 expression in HeLa NE . |
![]() | Western Blot analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody. Lane 1: PAK1 transfected lysate (Predicted MW: 49.6 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
![]() | Immunoprecipitation of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody. |
![]() | Immunofluorescence of monoclonal antibody to PAK1 on HeLa cell. [antibody concentration 35 ug/ml] |
![]() | Detection limit for recombinant GST tagged PAK1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.