3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11185
Human PANK2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_705902 |
| Gene Id | 80025 |
| Gene Symbols | PANK2 |
| Protein Name / Synonyms | C20orf48, FLJ17232, HARP, HSS, MGC15053, NBIA1, PKAN |
| Clonality | Monoclonal |
| Immunogen Sequence | IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPA DSEKCQKLPFDLKNP* |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (32.16 KDa). |
![]() | Immunoperoxidase of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 1 ~ 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged PANK2 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.