3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11198
Human PBX2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_002577 |
| Gene Id | 5089 |
| Gene Symbols | PBX2 |
| Protein Name / Synonyms | G17, HOX12, PBX2MHC |
| Clonality | Monoclonal |
| Immunogen Sequence | DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQM YSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (34.21 KDa). |
![]() | Western blot analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | PBX2 monoclonal antibody Western Blot analysis of PBX2 expression in Hela NE . |
![]() | Western Blot analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody. Lane 1: PBX2 transfected lysate(45.9 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to PBX2 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.