3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11200
Human PCAF monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH60823 |
| Gene Id | 8850 |
| Gene Symbols | PCAF,KAT2B |
| Protein Name / Synonyms | CAF, P, P/CAF, PCAF |
| Clonality | Monoclonal |
| Immunogen Sequence | LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAG TISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMT DSHVLEEAKKPRVMGDIPME |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | PCAF monoclonal antibody Western Blot analysis of PCAF expression in human uterus myoma. |
![]() | Western blot analysis of PCAF over-expressed 293 cell line, cotransfected with PCAF Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PCAF monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | PCAF monoclonal antibody Western Blot analysis of PCAF expression in LNCaP . |
![]() | PCAF monoclonal antibody Western Blot analysis of PCAF expression in Hela NE . |
![]() | Western Blot analysis of PCAF expression in transfected 293T cell line by PCAF monoclonal antibody. Lane 1: PCAF transfected lysate(93 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.