3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11248
Human PIGQ monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_683721.1 |
| Gene Id | 9091 |
| Gene Symbols | PIGQ |
| Protein Name / Synonyms | GPI1, MGC12693, c407A10.1, hGPI1 |
| Clonality | Monoclonal |
| Immunogen Sequence | HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGV EGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPG PSLPEPHGVYLRMFPGEV |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Western Blot analysis of PIGQ expression in transfected 293T cell line by PIGQ monoclonal antibody. Lane 1: PIGQ transfected lysate(84.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to PIGQ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 4 ug/ml] |
![]() | Detection limit for recombinant GST tagged PIGQ is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.