3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11252
Human PIK3CA monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_006209 |
| Gene Id | 5290 |
| Gene Symbols | PIK3CA |
| Protein Name / Synonyms | MGC142161, MGC142163, PI3K, p110-alpha |
| Clonality | Monoclonal |
| Immunogen Sequence | DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLF INLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEY FMKQMNDAHHGGWTTKMDWIFHTIKQHALN |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Proximity Ligation Analysis, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Proximity Ligation Analysis of protein-protein interactions between APPL1 and PIK3CA HeLa cells were stained with anti-APPL1 rabbit purified polyclonal 1:1200 and anti-PIK3CA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Detection limit for recombinant GST tagged PIK3CA is approximately 1ng/ml as a capture antibody. |
Your cart is empty.