3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11265
Human PIP5K1C monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_036530 |
| Gene Id | 23396 |
| Gene Symbols | PIP5K1C |
| Protein Name / Synonyms | KIAA0589, LCCS3, PIP5K-GAMMA, PIP5Kgamma |
| Clonality | Monoclonal |
| Immunogen Sequence | RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYF PTDERSWVYSPLHYSAQAPPASDGESD |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.51 KDa). |
![]() | Immunoprecipitation of PIP5K1C transfected lysate using anti-PIP5K1C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PIP5K1C MaxPab rabbit polyclonal antibody. |
Your cart is empty.