3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11275
Human PLCG1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_002651 |
| Gene Id | 5335 |
| Gene Symbols | PLCG1 |
| Protein Name / Synonyms | PLC-II, PLC1, PLC148, PLCgamma1 |
| Clonality | Monoclonal |
| Immunogen Sequence | LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRE RGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADH FDSRERRAPRRTRVNGDNRL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Proximity Ligation Analysis, ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | PLCG1 monoclonal antibody Western Blot analysis of PLCG1 expression in Hela NE . |
![]() | Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1 HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40 ug/ml] |
![]() | Detection limit for recombinant GST tagged PLCG1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.