3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11280
Human PLP1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_000524 |
| Gene Id | 5354 |
| Gene Symbols | PLP1 |
| Clonality | Monoclonal |
| Immunogen Sequence | YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFP GKVCGSNLLSICKTAE |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (31.9 KDa). |
![]() | Immunofluorescence of monoclonal antibody to PLP1 on HeLa cell. |
![]() | Detection limit for recombinant GST tagged PLP1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.