3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11283
Human PML monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | AAH00080 |
| Gene Id | 5371 |
| Gene Symbols | PML |
| Protein Name / Synonyms | MYL, PP8675, RNF71, TRIM19 |
| Clonality | Monoclonal |
| Immunogen Sequence | RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKE ARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVF LPNSNHVASGAGEAEERVVV |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Proximity Ligation Analysis, ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | PML monoclonal antibody. Western Blot analysis of PML expression in PC-12. |
![]() | PML monoclonal antibody Western Blot analysis of PML expression in Hela NE . |
![]() | Proximity Ligation Analysis of protein-protein interactions between TP53 and PML HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PML mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged PML is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.