3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11301
Human PPIE monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_006103 |
| Gene Id | 10450 |
| Gene Symbols | PPIE |
| Protein Name / Synonyms | CYP-33, MGC111222, MGC3736 |
| Clonality | Monoclonal |
| Immunogen Sequence | ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDY ETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNL AKPMRIKEGSSRPVWSDDD |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | PPIE monoclonal antibody Western Blot analysis of PPIE expression in Raw 264.7. |
![]() | PPIE monoclonal antibody Western Blot analysis of PPIE expression in PC-12. |
![]() | PPIE monoclonal antibody Western Blot analysis of PPIE expression in NIH/3T3. |
![]() | PPIE monoclonal antibody Western Blot analysis of PPIE expression in Hela NE . |
![]() | Western Blot analysis of PPIE expression in transfected 293T cell line by PPIE monoclonal antibody. Lane 1: PPIE transfected lysate(33.4 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to PPIE on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged PPIE is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.