3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11318
Human PRDX4 monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH03609 |
| Gene Id | 10549 |
| Gene Symbols | PRDX4 |
| Protein Name / Synonyms | AOE37-2, PRX-4 |
| Clonality | Monoclonal |
| Immunogen Sequence | CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEG TAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIA FGDRLEEFRSINTEVVACSV |
| Isotype | Kappa, IgG3 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | PRDX4 monoclonal antibody. Western Blot analysis of PRDX4 expression in human liver. |
![]() | Western Blot analysis of PRDX4 expression in transfected 293T cell line by PRDX4 monoclonal antibody . Lane 1: PRDX4 transfected lysate(30.5 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.