3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11330
Human PRKG1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_006249 |
| Gene Id | 5592 |
| Gene Symbols | PRKG1 |
| Protein Name / Synonyms | CGKI, DKFZp686K042, FLJ36117, MGC71944, PGK, PKG, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha |
| Clonality | Monoclonal |
| Immunogen Sequence | RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEA ILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVG SLVYVMEDGKVEVTKEGV |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Immunoperoxidase of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged PRKG1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.