3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 130-00024
Rabbit Anti-Human PRL Antibody
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | P01236 |
| Gene Id | 5617 |
| Gene Symbols | PRL |
| Clonality | Polyclonal |
| Immunogen | The immunogen was a synthetic peptide (prolactin). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified from rabbit serum by Protein G affinity chromatography. |
| Immunogen Sequence | CKENEIYPVWSGLPSLQMADEESRLSAYYN |
| Recommended Applications | ELISA (recommended work dilution= 1: 64, 000), Western Blotting (recommended work dilution= 1:1, 000), (see image) Western blot analysis of recombinant human PRL, using anti-PRL antibody (1 :1, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in PBS without preservatives. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Research Area | Angiogenesis |
| Shipping Type | Ambient temperature |
| Storage | -20°C |

Your cart is empty.