3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-PRL Antibody, Biotinylated
Catalog #: 130-00024B-50
Rabbit anti-PRL Biotinylated Antibody, 50 ug
Product Description
Specifications
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P01236 |
| Gene Id | 5617 |
| Gene Symbols | PRL |
| Clonality | Polyclonal |
| Immunogen | The immunogen was a synthetic peptide (prolactin). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified from rabbit serum by Protein G affinity chromatography. |
| Immunogen Sequence | CKENEIYPVWSGLPSLQMADEESRLSAYYN |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1: 64, 000), Western Blotting (recommended work dilution= 1:1, 000), (see image) Western blot analysis of recombinant human PRL, using anti-PRL antibody (1 :1, 000) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Research Area | Angiogenesis |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Prolactin (PRL) also known as luteotropic hormone (LTH) is a protein that in humans is encoded by the PRL gene. Prolactin is a peptide hormone discovered by Henry Friesen. Prolactin also acts in a cytokine-like manner and as an important regulator of the immune system. Prolactin has important cell cycle related functions as a growth-, differentiating- and anti-apoptotic factor. As a growth factor binding to cytokine like receptors it has also profound influence on hematopoiesis, angiogenesis and is involved in the regulation of blood clotting through several pathways. Prolactin acts in endocrine, autocrine, and paracrine manner through the prolactin receptor and a large number of cytokine receptors.
Storage / Stability
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Specificity
This antibody can specifically bind to human prolactin. The cross reactivity with mouse and rat prolactin was not tested.
References
- Evans, AM. et al. (1989). "Mapping of prolactin and tumor necrosis factor-beta genes on human chromosome 6p using lymphoblastoid cell deletion mutants". Somat. Cell Mol. Genet. 15 (3): 20313.
- Bole-Feysot, C. et al. (1998). "Prolactin (PRL) and its receptor: Actions, signal transduction pathways and phenotypes observed in PRL receptor knockout mice". Endocrine Reviews 19 (3): 225268.
Expiration:
12 months from the date of shipment when stored properly.