3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 130-00024B-50
Rabbit anti-PRL Biotinylated Antibody, 50 ug
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P01236 |
| Gene Id | 5617 |
| Gene Symbols | PRL |
| Clonality | Polyclonal |
| Immunogen | The immunogen was a synthetic peptide (prolactin). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified from rabbit serum by Protein G affinity chromatography. |
| Immunogen Sequence | CKENEIYPVWSGLPSLQMADEESRLSAYYN |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1: 64, 000), Western Blotting (recommended work dilution= 1:1, 000), (see image) Western blot analysis of recombinant human PRL, using anti-PRL antibody (1 :1, 000) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Research Area | Angiogenesis |
| Shipping Type | Ambient temperature |
| Storage | -20°C |

Your cart is empty.