3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11334
Human PRPS2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_002756 |
| Gene Id | 5634 |
| Gene Symbols | PRPS2 |
| Protein Name / Synonyms | PRSII |
| Clonality | Monoclonal |
| Immunogen Sequence | AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKA NEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSA GATKVYAILTHGIFSGPAISRINNAAFEAV |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | Western blot analysis of PRPS2 over-expressed 293 cell line, cotransfected with PRPS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRPS2 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody. Lane 1: PRPS2 transfected lysate(34.8 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.