3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11338
Human PSCD3 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH08191 |
| Gene Id | 9265 |
| Gene Symbols | PSCD3,CYTH3 |
| Protein Name / Synonyms | ARNO3, GRP1, PSCD3 |
| Clonality | Monoclonal |
| Immunogen Sequence | MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTH TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIK ACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASIS RDPFYDMLATRKRRIANKK* |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (45.8 KDa). |
![]() | PSCD3 monoclonal antibody 1A9 Western Blot analysis of PSCD3 expression in Hela NE . |
![]() | Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody 1A9. Lane 1: PSCD3 transfected lysate(46.3 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged PSCD3 is approximately 3ng/ml as a capture antibody. |
Your cart is empty.