3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11340
Human PSMA1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH02577 |
| Gene Id | 5682 |
| Gene Symbols | PSMA1 |
| Protein Name / Synonyms | HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30 |
| Clonality | Monoclonal |
| Immunogen Sequence | MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKS KTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP QRKAQPAQPADEPAEKADEPMEH |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (54.67 KDa). |
![]() | Western blot analysis of PSMA1 over-expressed 293 cell line, cotransfected with PSMA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMA1 monoclonal antibody 1C7. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | PSMA1 monoclonal antibody 1C7 Western Blot analysis of PSMA1 expression in HeLa . |
![]() | Western Blot analysis of PSMA1 expression in transfected 293T cell line by PSMA1 monoclonal antibody 1C7. Lane 1: PSMA1 transfected lysate(30.2 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to PSMA1 on HeLa cell. [antibody concentration 60 ug/ml] |
Your cart is empty.