3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11341
Human PSMA8 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_653263 |
| Gene Id | 143471 |
| Gene Symbols | PSMA8 |
| Protein Name / Synonyms | MGC26605, PSMA7L |
| Clonality | Monoclonal |
| Immunogen Sequence | GFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEK NYTEDAIASDSEAIKLAIKALLEVVQSGGRNIELAIIRRN QPLKMFSAKEVELYVTEIEK |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | PSMA8 monoclonal antibody Western Blot analysis of PSMA8 expression in PC-12. |
![]() | PSMA8 monoclonal antibody Western Blot analysis of PSMA8 expression in NIH/3T3. |
![]() | PSMA8 monoclonal antibody Western Blot analysis of PSMA8 expression in K-562 . |
![]() | PSMA8 monoclonal antibody Western Blot analysis of PSMA8 expression in Jurkat . |
Your cart is empty.