3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11374
Human RAB3B monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH05035 |
| Gene Id | 5865 |
| Gene Symbols | RAB3B |
| Protein Name / Synonyms | None |
| Clonality | Monoclonal |
| Immunogen Sequence | IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGF DFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLG SSKNTRLSDTPPLLQQNCSC |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | RAB3B monoclonal antibody. Western Blot analysis of RAB3B expression in IMR-32 . |
![]() | Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody . Lane 1: RAB3B transfected lysate(24.758 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to RAB3B on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged RAB3B is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.