3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11399
Human RARA monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse |
| Host Species | Mouse |
| Accession Number | NP_000955 |
| Gene Id | 5914 |
| Gene Symbols | RARA |
| Protein Name / Synonyms | NR1B1, RAR |
| Clonality | Monoclonal |
| Immunogen Sequence | QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEP LLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAER VITLKMEIPGSMPPLIQEMLENSEGLDTLS |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Proximity Ligation Analysis, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | RARA monoclonal antibody. Western Blot analysis of RARA expression in NIH/3T3 . |
![]() | RARA monoclonal antibody Western Blot analysis of RARA expression in HeLa NE . |
![]() | Proximity Ligation Analysis of protein-protein interactions between RXRA and RARA HeLa cells were stained with anti-RXRA rabbit purified polyclonal 1:1200 and anti-RARA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Your cart is empty.