3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11437
Human RET monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH03072 |
| Gene Id | 5979 |
| Gene Symbols | RET |
| Clonality | Monoclonal |
| Immunogen Sequence | NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPV SLHLPSTYSLSVSRRARRFAQIGKVCVENCLADLTGDAVS GRDEARSSGLGSQKHPGS |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 0.5 mg/ml |
| Recommended Applications | Proximity Ligation Analysis, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Proximity Ligation Analysis of protein-protein interactions between MAPK3 and RET HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RET mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Detection limit for recombinant GST tagged RET is approximately 3ng/ml as a capture antibody. |
Your cart is empty.