3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11442
Human RFC4 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH17452 |
| Gene Id | 5984 |
| Gene Symbols | RFC4 |
| Protein Name / Synonyms | A1, MGC27291, RFC37 |
| Clonality | Monoclonal |
| Immunogen Sequence | GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVV KDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAE VDKCLADGADEHLQLISLCATVMQQLSQNC |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.73 KDa). |
![]() | Western blot analysis of RFC4 over-expressed 293 cell line, cotransfected with RFC4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RFC4 monoclonal antibody . GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | RFC4 monoclonal antibody Western Blot analysis of RFC4 expression in K-562 . |
![]() | Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody . Lane 1: RFC4 transfected lysate(39.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.