3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11443
Human RGL1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_055964 |
| Gene Id | 23179 |
| Gene Symbols | RGL1 |
| Protein Name / Synonyms | KIAA0959, RGL |
| Clonality | Monoclonal |
| Immunogen Sequence | EVKPVGEPTQEVSKFKLSTKVESTGHWLVEDHVRIWEVLK TEESSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLG VEGDQLPPGHTVSQYETCKIRTIKAGTL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.62 KDa). |
![]() | RGL1 monoclonal antibody Western Blot analysis of RGL1 expression in A-431 . |
![]() | Western Blot analysis of RGL1 expression in transfected 293T cell line by RGL1 monoclonal antibody . Lane 1: RGL1 transfected lysate(90.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to RGL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged RGL1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.