3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11444
Human RGS13 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_658912.1 |
| Gene Id | 6003 |
| Gene Symbols | RGS13 |
| Protein Name / Synonyms | MGC17173 |
| Clonality | Monoclonal |
| Immunogen Sequence | NIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREI NIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPR FLKSEMYQKLLKTMQSNNSF |
| Isotype | Kappa, IgG2b |
| Recommended Applications | IHC, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | Western Blot analysis of RGS13 expression in transfected 293T cell line by RGS13 monoclonal antibody. Lane 1: RGS13 transfected lysate(19.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to RGS13 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Your cart is empty.