3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11451
Human RICTOR monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_689969 |
| Gene Id | 253260 |
| Gene Symbols | RICTOR |
| Protein Name / Synonyms | DKFZp686B11164, KIAA1999, MGC39830, mAVO3 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLRE ILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFH YEDIIICLRLALLNEAKE |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Western Blotting, ELISA |
| Research Area | mTOR Signaling |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | RICTOR monoclonal antibody Western Blot analysis of RICTOR expression in Hela NE . |
![]() | Western Blot analysis of RICTOR expression in transfected 293T cell line by RICTOR monoclonal antibody. Lane 1: RICTOR transfected lysate(29.8 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.