3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11466
Human RNF2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_009143 |
| Gene Id | 6045 |
| Gene Symbols | RNF2 |
| Protein Name / Synonyms | BAP-1, BAP1, DING, HIPI3, RING1B, RING2 |
| Clonality | Monoclonal |
| Immunogen Sequence | PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFR PHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEE LRSKGESNQMNLDTASEKQ |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in human placenta. |
![]() | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in Raw 264.7. |
![]() | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in PC-12. |
![]() | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in NIH/3T3. |
![]() | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in Hela NE . |
![]() | Immunofluorescence of monoclonal antibody to RNF2 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged RNF2 is approximately 3ng/ml as a capture antibody. |
Your cart is empty.