3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11491
Human RPS6KA2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH02363 |
| Gene Id | 6196 |
| Gene Symbols | RPS6KA2 |
| Protein Name / Synonyms | HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, pp90RSK3 |
| Clonality | Monoclonal |
| Immunogen Sequence | YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHP WVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPR LEPVLSSNLAQRRGMKRLTSTRL |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Proximity Ligation Analysis, Western Blotting, ELISA, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.07 KDa). |
![]() | Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RPS6KA2 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | RPS6KA2 monoclonal antibody Western Blot analysis of RPS6KA2 expression in Hela NE . |
![]() | Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody. Lane 1: RPS6KA2 transfected lysate(83.2 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between MAPK3 and RPS6KA2 HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to RPS6KA2 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.